SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q4Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q4Y7
Domain Number 1 Region: 280-460
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 81-178
Classification Level Classification E-value
Superfamily PH domain-like 0.000000403
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1Q4Y7
Sequence length 762
Comment (tr|G1Q4Y7|G1Q4Y7_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000018770} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
TETLSVKQETLRGQAGRSSSLTGVSTPERPGTKKRMKALVGRRRRAPSLTLDNALQKWPA
TKERPPAGVDTHAFLSSFVALLLDGLVELKRGLQRWERHLFLFNDLLVVAKIKYNNNFKR
KNKIKLSDRWAASCVGEVGDGSTDAMRSLVLGWPTVNLVATFRPEQKGKWLSLLQRCLSL
EKEDWPKSIPLKTFTKDIGDCACCKTITMRNSPFVLRELFLTEQLPRERWCQFTLQPSPL
AAAQKLSQSGEKTFKRRGCSIKRGSSTRPGNLPMSPASPTPGKLFRVSLPSICENDNLPQ
PVSHMLFILDQKGPLTKGIFRLSANVTSRRELKEKLNSVIVSVLKDFLRNIPGSIFSSDL
CHHWVCVMDQGNDEEKINTIQRLLDQLLRASVVLPYLFGVLPNIEQHSSSNQMMTFNLAV
CITASILWPPASSSPELENKFINKDTLLIQFLIENCCGIFGEETTSLFGEVSVRCDTEQN
ASHISYYDSLEGEQNGAEVPGGDLVKNLGQGSRNMDSALTPSGDDLDQPEVDALLTLSDF
DLDRSKNEDIRLLESKPVTVIVLYREPTLQDPAGPLSGMTTPSCLSTAAADAPESPRQHQ
CSEASTNDLDSKLSLRQERLRKSSRDAILSQKDEDHRQQNQPLQEEGKTYFKQSLVTVTD
IKKSATNTNAKEESLFGNEGNHVNLLPESKPGAISIASCSHMSSRDHPRSQPFDSDTSGD
ALPHTRMPSRRQQHCSEPNADDQPSKLSCLRRMFSKKQKKTT
Download sequence
Identical sequences G1Q4Y7
ENSMLUP00000018770 ENSMLUP00000018770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]