SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q5F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q5F2
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily Ferritin-like 4.36e-20
Family Ferritin 0.000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q5F2
Sequence length 105
Comment (tr|G1Q5F2|G1Q5F2_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000018935} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
NQCSDHTLFQEMQFSQDNACGKTHYAMEDAMALDRNLHQALFDLHALGSTHTEPHLCDFL
PYYFLDEDVKLNKKMGDHLINLRSCLAPRLGWGEYLFESFTLKHN
Download sequence
Identical sequences G1Q5F2
ENSMLUP00000018935 ENSMLUP00000018935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]