SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q5F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q5F8
Domain Number 1 Region: 342-407
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-19
Family SH3-domain 0.00098
Further Details:      
 
Domain Number 2 Region: 8-75
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-18
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 3 Region: 702-771
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-17
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 4 Region: 71-135
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q5F8
Sequence length 772
Comment (tr|G1Q5F8|G1Q5F8_MYOLU) SH3 domain containing ring finger 3 {ECO:0000313|Ensembl:ENSMLUP00000018941} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SH3RF3 OC=Vespertilionidae; Myotis.
Sequence
SWAPLVDPVVQLPCGKALYSYEGKEPGDLKFNKGDVIILRRRVDEHWFHGELRGTHGFLP
ASYVQCLRPLPPTPPQGKALYDFEMKDRDQDQDCLTFTKDEILTVIRRVDDNWAEGMLGD
KIGIFPLLYVELNDSAKQLIAMDKPSDPGAVASVAPGLTLSSTGAVSAFQQRVDGKKNAK
KRHSFTAVSLTHRSSQAASHRHSVEISAPVLISSSDPRATARIRDLAHVSCSAPTQVTSS
GHGQTREGCIRKVPGTPLAPGECGEFWPGPAPSQSTPCLLSPRPFHPPPTLASVIIAAFR
EGGGRAWNQCPPQPAACGGGPWPAVVNSSSILKLKPTFSPTLDRRYLALYTYKPQKSDEL
ELRKGEMYCVLEKCQDGWFKGTSLRSGLSGVFPGNYVTPASSGTWSVSGTWAPLGGAGPP
GNNVVGGSPLAKGMATSIHPGGGSLSSPATAARAALPLATPQAQHQAASPPVGSCLWHSA
PPAASQARSTVPTGVAHAQDQPTTMVSPLCTQNSPSRLPTASLRPHSMVSLQHLHQPPVQ
TITGAQCPWPAIPLTSAASAVTPPNVTAANLNGEAGVGTVSGLSTSSPTNVSKCGLASHS
EHDDAKEKKSGLLKLLAGASTKKKNRSPPSISPTHDPHVAVDASLQGAVGLEVSSLSLHG
RAGSCPIESKIQGAMGMEPLHRKTGSLDLNFSSSPSRKAPFSMAAARPEPKPFPRERYRV
VVSYPPQSEAEIELKEGDIVFVHKKREDGWYKGTLQRNGRTGLFPGSFVESF
Download sequence
Identical sequences G1Q5F8
ENSMLUP00000018941 ENSMLUP00000018941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]