SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q5M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q5M6
Domain Number 1 Region: 7-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.74e-52
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 357-396,431-568
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.93e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  G1Q5M6
Domain Number - Region: 258-283,327-374
Classification Level Classification E-value
Superfamily TPR-like 0.000921
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1Q5M6
Sequence length 617
Comment (tr|G1Q5M6|G1Q5M6_MYOLU) Fem-1 homolog C {ECO:0000313|Ensembl:ENSMLUP00000019009} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=FEM1C OC=Vespertilionidae; Myotis.
Sequence
MDLKTAVFNAARDGKLRLLTKLLASKSKEEISSLISEKTNGATPLLMAARYGHLDMVEFL
LEQCSASIEIGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLNHGASVNNTTLTNSTPL
RAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRKSV
KGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSASVTGHTNIVDFLTHHAQTS
KTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDRTNIISKPVPQTLIMAYDYAK
EVNSSEELEGLIADPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINL
WKYALDMQQNNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVL
EIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDYFKKQTIYRFLKLHPRGK
NNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNH
PDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIY
YKGHIPEKLETFVSLHR
Download sequence
Identical sequences G1Q5M6
ENSMLUP00000019009 ENSMLUP00000019009 XP_006081200.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]