SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q6Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q6Y3
Domain Number 1 Region: 288-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-56
Family SPRY domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 6-76
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-21
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  G1Q6Y3
Domain Number - Region: 135-197
Classification Level Classification E-value
Superfamily t-snare proteins 0.0785
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q6Y3
Sequence length 468
Comment (tr|G1Q6Y3|G1Q6Y3_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000019466} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MAIEAALAVLQTEINCPICLDDLRDPVTIECGHNFCRSCIQQSWADVQDRFPCPVCRHPC
KDRHMRSNTQLGRMVDITKLLQITRGKMKQQEERRFCKKHNKSLTLFCEEDRELLCPLCT
QPPDHQGHQVRPVEEAASHHRQRLSSYIEPLKKQVADIQKLVATQDRKLSELREKVENRR
AKLASEFDNLIQSVEHEQEAVLSRVAAEEKHIQRNLIANKTAFSDHISKLKVQLKEMAEK
SVMSDVKLLMNIKGVFRHCENLEPPGVYCFQFSREEFSLPPQCSALQKIIQRFREEVTLD
PETAHPNLVVSEDKKSVTFVRKKQRVHKNPKGFAVDPVVLGTEGFDCGRHYWEVQVDDKP
EWAVGVCKDTLSKEEKQPLLRQENRCWTIQLKDGDYVAQGPVPVTLVLKEMPRGIGIYLD
YELGQVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTVFALKD
Download sequence
Identical sequences G1Q6Y3
XP_006082058.1.53796 ENSMLUP00000019466 ENSMLUP00000019466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]