SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q6Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q6Z6
Domain Number 1 Region: 60-218
Classification Level Classification E-value
Superfamily Ferritin-like 5.75e-38
Family Ferritin 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1Q6Z6
Sequence length 225
Comment (tr|G1Q6Z6|G1Q6Z6_MYOLU) Ferritin {ECO:0000256|RuleBase:RU361145} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
SLPCSRFFKRKSVSIMLLIATRLKYEAGAAREAWVPGARGKPVPAAGGRKAYPCTNFVHW
TSSQASPTQVRQNYHQDQEASSNHQINLELYAPYIYLPMSYYFGREDVALKNFVKYFLYQ
SHEKGERAQKLMKLQIQRVGGIFLQDIMQTENGLNAMECALHLEKILELHKLATVKNDPY
LYDFNEFNEEVKTKLCKMPSPPPQFGTAEYLFDKHTLGDSDESHG
Download sequence
Identical sequences G1Q6Z6
ENSMLUP00000019479 ENSMLUP00000019479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]