SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q7E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q7E5
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.01e-71
Family Mammalian PLC 0.000000151
Further Details:      
 
Domain Number 2 Region: 480-543,584-725
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 4.58e-63
Family C-terminal domain of PLC-beta 0.0000749
Further Details:      
 
Domain Number 3 Region: 261-379
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.13e-24
Family PLC-like (P variant) 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1Q7E5
Sequence length 726
Comment (tr|G1Q7E5|G1Q7E5_MYOLU) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PLCB1 OC=Vespertilionidae; Myotis.
Sequence
SPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEG
SSKKKLSEQVSNTCSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMA
TEEMSNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSR
IYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMR
RPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTK
TSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICL
RNERNQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEE
DVKKEPDPGETSSEALSEAGTTPAENGVNHTTSLAPKPPSQAIHSQPAPGPGKAPAKTED
LIHSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKELVKRHHKKTTDLIKEHTTKYNEIQ
NDYLRRRAALEKTARKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQL
LNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKR
QEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQIL
DEKPKV
Download sequence
Identical sequences G1Q7E5
ENSMLUP00000019628 ENSMLUP00000019628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]