SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q922 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q922
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-28
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q922
Sequence length 215
Comment (tr|G1Q922|G1Q922_MYOLU) Family with sequence similarity 109 member A {ECO:0000313|Ensembl:ENSMLUP00000020205} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=FAM109A OC=Vespertilionidae; Myotis.
Sequence
LAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDVASREPVGVIILEGCT
VELVEAAEEFTFAVRFAEARARTYVLAAESQAAMEGWVKALSRASFDYLRLVVRELEQQL
AAMRAGGCPPPPRRPRALLPKENGCAVWSAEPPAASTGTSTGARSGPERPPLPPRRRASA
PNGPLDSASFLQLHEWYGQEVRALRSQWLRSRAQP
Download sequence
Identical sequences G1Q922
ENSMLUP00000020205 ENSMLUP00000020205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]