SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q971 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q971
Domain Number 1 Region: 547-612,984-1088
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-31
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 2 Region: 1111-1212
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-21
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 892-982
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-19
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q971
Sequence length 1233
Comment (tr|G1Q971|G1Q971_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000020254} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LOC106699048 OC=Vespertilionidae; Myotis.
Sequence
SPVSSLGEPQPANHACQKNVKGLEKVKGDTSEAVSHQTRTLGKSKGNGDEHTSASMNEKQ
NSSFLPKDKKQPPSDSKRSREKENDDSSPSISHQLKKVLPAIMFNGCEGSLSGKITLQDF
PNTVEGSKQEKGKIITEVKYGDFNVQVANKNRFFSKIGIQFPTKKRCPKCHQCYSGRHIP
RCYPSRSCSYKYRNISIEEIKSESPSKHEGETARTESSSLEVSIVGKGIKVKYMSKKQNI
IVNITHPKRRGKTAKYGNVSSDHTTKEPPRSSAQPGVRLPEKGRLGNKHRSPDPLQASPP
ALSAVQKEVNPDTAVVSLCSTPERKTKPDRLFSVLDDCELESAISQQKDSKINRNTSQKK
HFFEAEALLRNVFPTSHDALKTTSLSNADLRKMPFEDRKVNFDIPENITADSYRQQSTGG
RNYLPSTIINISPVQRGQDSDFYSSSSLNGKHTGAKAASIYGKGSKIPPADDGENSKCKS
FPPSQNTVKPSIPSCPFTGASGQSEPKETPGHAFPFGLSAECVVDYEEEHADGTGRDFTT
ATLHSDSHTHMQQLLKTKSTQCPSLSCASSGGLAAGSPLNSSSHSSVEWSQTGSQASHAE
MAAPSNTEVSAVTSITDELEQRLIIQNDKESMVDSNCPMGIKHLKESPSFGGNVEKDELL
IRPVVKTTRHREFEDLSNENHSEACFQMKFPPNTTEFNSAVCAADNLFLTEKPLTSDADQ
YSKQDEITLGLTSFTQEAAECQSIASMRPNAEGDKKETYYHQMDILHSPQKQKALKDWNL
QINSLKLPQELPPRGTRASDGSQEEAIDQWARRRQQFKDGKSSSSAGGSSFASNITEGSI
ISEDSCSVDFGFRVDIEEKGFYTEIFHSAAWIFRGDDGNPGDSPRCLSKKPRPAAVRERT
LRLFKGTDDCPWGFQIQFSKPIVVTEVDANSAAEEAGLQIGDVVLAVNGTEVTSAEHAEA
VHLARKGPDILTLVVGSDISRCPNTPRPTCRGYLHKRTHSGFVKGWRKRWFVLKHDGCLH
YYRHKKDEGKCPPLEVIKLEGAEVDIDSSLGKPFVFNCVPQSGNRTFCLCATSNQEMKRW
LEAMDKAAHPVRQNHVWEDVTLHNSSLPPLAIKNPECLGLLHQLDRSTDLWAQRYCILKD
GCLYLYASIRSTQASGGLYLQGYRVNEQTLSFKQSIIELKPPSEEFKTFYFCAENKTENQ
RWITALKMSIKKWLPLHQAIQDFINRPLEETRM
Download sequence
Identical sequences G1Q971
ENSMLUP00000020254 ENSMLUP00000020254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]