SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q9I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q9I7
Domain Number 1 Region: 27-75
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000017
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q9I7
Sequence length 80
Comment (tr|G1Q9I7|G1Q9I7_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000020370} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MRQSSLSVLTGIFLLLCLHLAQPEWRAMDVVKPGHCPEFPLRCPFTMIPLCRRDRICKKD
KKCCFYNCRYQCMVPWESLD
Download sequence
Identical sequences G1Q9I7
ENSMLUP00000020370 ENSMLUP00000020370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]