SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q9U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q9U7
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.1e-62
Family Cyclophilin (peptidylprolyl isomerase) 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1Q9U7
Sequence length 164
Comment (tr|G1Q9U7|G1Q9U7_MYOLU) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363019} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MGNPTMYFNIAANGEPLGRVSFELFADKVSKTAENFLALSTGEKGFGYKGSCFHRIIPRL
MCQGGDFTRHNGTGGKFFHGEKLEDENFVLKHTGPGILSMANAGRNTNGFFFICAAKTEW
LDGKHVVFGRVKEGMDIVTARERFGSRNGRTSKKITIADGGQLY
Download sequence
Identical sequences G1Q9U7
ENSMLUP00000020480 ENSMLUP00000020480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]