SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QA16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QA16
Domain Number 1 Region: 32-241
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-32
Family Nuclear receptor ligand-binding domain 0.0000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QA16
Sequence length 253
Comment (tr|G1QA16|G1QA16_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000020549} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
PPPVQHLLPGPAQCLRPADEGAMVAGGDLFPGQPVSELIAQLLRAEPYPPGRFGGGGGSA
GAVLGIDKVCELAARLLLSAVEWRHAPFFPDLPVADQLSELFVLKATQAALLPAAAGLHA
ALMAADRAVAFMDPVRAFQEQVDKLGRLQVDSAEYGCLQAMALFTPDACGLDPAHVGSLQ
EKAQVALTEYRAQFPSQPQRFRHLLLAPALRAVPASLTSQLFFMRLVGKTPMEMLIRDML
LSGSTFHRPYGSG
Download sequence
Identical sequences G1QA16
ENSMLUP00000020549 ENSMLUP00000020549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]