SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QAM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QAM4
Domain Number 1 Region: 230-354
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-33
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 442-564
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-28
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 343-446
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-25
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-21
Family Cadherin 0.0065
Further Details:      
 
Domain Number 5 Region: 585-670
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000004
Family Cadherin 0.003
Further Details:      
 
Domain Number 6 Region: 30-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000957
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QAM4
Sequence length 807
Comment (tr|G1QAM4|G1QAM4_MYOLU) Protocadherin alpha 11 {ECO:0000313|Ensembl:ENSMLUP00000020757} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PCDHA11 OC=Vespertilionidae; Myotis.
Sequence
MFGVQRGGLDTQQLLLSLLLFALWEAGSGQVHYSVPEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKGRGDLLEVNLQNGILFVNSRIDREELCGRRAECSIHLEVVVERPLQVFHVE
VEVKDINDNPPVFSLREQKLLISESKPPDSHFPLEGASDADIGENALLTYRLSQNEYFSL
ELPRNSKQTNRLSLTLKKSLDREKTPEISLLLTAADQGKPELTGTVQLFICILDTNDNDP
EFEQPEYKVRLMENAAKETFVIKLNATDLDEGVNGEVTYSLLSVKPNGKPLFTIDKNSGE
VRVNGTLDYEKNKFYEIEVQATDKGNPPMAGHCTVWVEILDANDNAPEITVTSLSLPVPE
ATQPSTVIALISVSDRDSGANGQVICSLTPEVPFKIMSTFKNYYSLVLDSALDREKVSHY
ELVVTARDQGSPSLSATASLSVEVADVNDNAPLFAQPEYTVFVKENNPPGCHIFTVSARD
LDAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAG
VPPLGSNVTLQVFVLDENDNAPALLTPAPGGPGGAVSELVSLLVGAGHVVAKVRAVDADS
GYNAWLSYELLPAAGGARSPFRVGLYTGEISTTRALDEADSPRQRLLVLVKDHGEPALMA
TATVLLSLVDSGQAPKASSRASLGAQGSGTALVDVNVYLIIAICAVSSLLVLTLILYLAL
RCSTPPTEGACGPGKPVLVCSSAVGSWSYSQQRRQRVCSGEGPPKTDLMAFSPSLPPGPD
KEDGGERQETGSNHLEQVSAIGSLYFE
Download sequence
Identical sequences G1QAM4
ENSMLUP00000020757 ENSMLUP00000020757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]