SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QAQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QAQ3
Domain Number 1 Region: 75-198
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-24
Family Regulator of G-protein signaling, RGS 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QAQ3
Sequence length 206
Comment (tr|G1QAQ3|G1QAQ3_MYOLU) Regulator of G protein signaling 17 {ECO:0000313|Ensembl:ENSMLUP00000020786} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RGS17 OC=Vespertilionidae; Myotis.
Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERAETAERPTLTTK
MESIQVLEEGQKPGSWLHNLDLNLSFPQCFPLFQIFLRTRTSESFINLYLLRIEKTNPTK
YRTLIKRKSSKIYEIYLHALWPKDIYLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHR
DSFPRFLNSQIYKSFVESTASSTSES
Download sequence
Identical sequences G1QAQ3
ENSMLUP00000020786 ENSMLUP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]