SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QBB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QBB3
Domain Number 1 Region: 155-259
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.00000891
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QBB3
Sequence length 270
Comment (tr|G1QBB3|G1QBB3_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000020996} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
EDKSCEYDQLYEEYTRTSQELQMKRTTMEAFNETIKIFQEQGQTQEKFSKEYLERFRCEG
NEKEMQRILLNSEWLKSCISEIQSHTKLEKELQIQADNLGKRMNSLKPDLMQLRKIQDQY
LVWTQKGAQQKKINEWLGIKNETEDQYALMEDENDLPHHEERTWYVGKINPTQAEEMLNS
KRDGTFLIGESNRRGCYACSVVVGSDTKHCVIYRLATGLGFAEPYNLYGSLKELVLHDQH
TSLMQHSNALTITLAHPIKAPGVLSPSLVP
Download sequence
Identical sequences G1QBB3
ENSMLUP00000020996 ENSMLUP00000020996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]