SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QBX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QBX6
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Ferritin-like 5.41e-45
Family Ferritin 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QBX6
Sequence length 170
Comment (tr|G1QBX6|G1QBX6_MYOLU) Ferritin {ECO:0000256|RuleBase:RU361145} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
AHQNYSTEVEAVVNHLALANLHLRASHTYLSLGFYFDLEVALEGVGHFFSELVEKKPEGT
EHLLKLQNQHGGRILSQDVLKPPQEWGKTQDSMEAALALERNLNQALLELQTLSSTRTDF
HLCDCLENHFLGEQVKLIKKMGDHLTHLQAAHHQAGLGEYLLKRLTLKHD
Download sequence
Identical sequences G1QBX6
ENSMLUP00000021209 ENSMLUP00000021209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]