SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QCI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QCI5
Domain Number 1 Region: 144-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000354
Family cAMP-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QCI5
Sequence length 368
Comment (tr|G1QCI5|G1QCI5_MYOLU) Popeye domain containing 2 {ECO:0000313|Ensembl:ENSMLUP00000021418} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=POPDC2 OC=Vespertilionidae; Myotis.
Sequence
MSANSSTLGQRLWQGPVCAGWKQDMEGALYHLANCVLLLGFMGGSGVYGCFYLFGFLGTG
YVCYVLWGWFNACGLDIVIWNFLLAMACLLQLAHLVYRLRKDTLPEEFDLLYKTLCVPLQ
VPMQAYKEIVRCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLPPSEEGVFQVTLTAETPCSYISWPRKSLHLLLAKERYISRLFSVLLGYD
ISEKLYALNEKLFAKFGLCFDIRLPSLYHVLGSAASDAGPESEKEDEEVHEPAPAPPQAM
PTPVQHMPPCSPLPAATHPPAQPSRARMSRPDSDGLGEDSTSLVLEDFEEVSGSESFMDY
RSDGEYMR
Download sequence
Identical sequences G1QCI5
XP_014313214.1.53796 ENSMLUP00000021418 ENSMLUP00000021418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]