SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QD33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QD33
Domain Number 1 Region: 80-161
Classification Level Classification E-value
Superfamily HMG-box 2.88e-31
Family HMG-box 0.0000319
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily HMG-box 2.09e-21
Family HMG-box 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QD33
Sequence length 188
Comment (tr|G1QD33|G1QD33_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000021616} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MANSDPKKPQGKMSAYAFFVQTCREEHKKKNPEVPVSFAEFSKCSERWKTMSAKEKSKFD
EMAKADKVHYDQEMKDYGPAKGGKKKKEPNVPKRPTSGFFLFCSEFRPKIKSTNPGISIG
DVARKLGEMWNNLSDSEKQPYNNKAEKLKEKYEKDLANYKSKVKFDGAKGLAKVAQKKVE
EDEEEEEE
Download sequence
Identical sequences G1QD33
ENSMLUP00000021616 ENSMLUP00000021616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]