SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QDH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1QDH7
Domain Number - Region: 12-73
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0152
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QDH7
Sequence length 127
Comment (tr|G1QDH7|G1QDH7_MYOLU) Chromosome 3 open reading frame 14 {ECO:0000313|Ensembl:ENSMLUP00000021760} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=C3orf14 OC=Vespertilionidae; Myotis.
Sequence
MTSLFAQEIRLSKRHEEIVSQRLKLLQQMESKFEDQNKEKASQIQAAEAAFKRNLSLLKD
IEAAEKSLQTWSHPLPPPEVVSLETLYWASVEEYIPKWEQFLLGRAPYPIGVENQNEAEN
TIRNKAQ
Download sequence
Identical sequences G1QDH7
ENSMLUP00000021760 ENSMLUP00000021760 XP_006089105.1.53796 XP_014311602.1.53796 XP_014311603.1.53796 XP_014311604.1.53796 XP_014311605.1.53796 XP_014311606.1.53796 XP_014311607.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]