SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QEH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QEH3
Domain Number 1 Region: 341-448
Classification Level Classification E-value
Superfamily Anthrax protective antigen 9.42e-19
Family Anthrax protective antigen 0.012
Further Details:      
 
Domain Number 2 Region: 1774-1854
Classification Level Classification E-value
Superfamily E set domains 6.4e-17
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 3 Region: 1858-1940
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000109
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 3276-3478
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000114
Family Galacturonase 0.078
Further Details:      
 
Domain Number 5 Region: 2040-2127
Classification Level Classification E-value
Superfamily E set domains 0.000000000000012
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 6 Region: 1201-1278
Classification Level Classification E-value
Superfamily E set domains 0.000000000000102
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 7 Region: 1029-1106
Classification Level Classification E-value
Superfamily E set domains 0.000000000000242
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 8 Region: 1119-1198
Classification Level Classification E-value
Superfamily E set domains 0.000000000000583
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 9 Region: 1604-1687
Classification Level Classification E-value
Superfamily E set domains 0.00000000000255
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 10 Region: 1944-2035
Classification Level Classification E-value
Superfamily E set domains 0.00000000000868
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 
Domain Number 11 Region: 240-329
Classification Level Classification E-value
Superfamily E set domains 0.000000000205
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 12 Region: 1507-1574
Classification Level Classification E-value
Superfamily E set domains 0.00000000021
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 13 Region: 1694-1767
Classification Level Classification E-value
Superfamily E set domains 0.000000000851
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 14 Region: 112-210
Classification Level Classification E-value
Superfamily E set domains 0.00000000529
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 15 Region: 1-94
Classification Level Classification E-value
Superfamily E set domains 0.0000000878
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Domain Number 16 Region: 1350-1447
Classification Level Classification E-value
Superfamily Cupredoxins 0.000000562
Family Plastocyanin/azurin-like 0.063
Further Details:      
 
Domain Number 17 Region: 1294-1366
Classification Level Classification E-value
Superfamily E set domains 0.00000129
Family E-set domains of sugar-utilizing enzymes 0.0099
Further Details:      
 
Domain Number 18 Region: 2144-2204,2416-2632
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000581
Family Galacturonase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QEH3
Sequence length 4116
Comment (tr|G1QEH3|G1QEH3_MYOLU) PKHD1 like 1 {ECO:0000313|Ensembl:ENSMLUP00000022106} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PKHD1L1 OC=Vespertilionidae; Myotis.
Sequence
KVTEIIPKYGSINGATRLTIKGEGFAQANQFNYGVDDAELGNTVQLVSSFRSISCDVEKD
ASHSTHITCYTRAMPEDSYTVRVSVDGVPVTENNTCRGLIHSRACSFYAKSFRTPTIRSI
TPLSGTPGTLITIQGRIFTDVYGSNTARSSNGKNVRILRVYIGGMPCELLIPQSDDLYGL
KLDHPSGDMGSMICKTTGTYIGHHNVSFILDNDYGRSFPEKMAYFVSSLNKISMFQTYAE
ITMISPSQGSIQGGTTLIISGRFFDQTDFPVRVLVGGQACDVLNVTENTIYCKTSPKPDS
LRTIHPGGRGLKLEVWNNSRPVHLEEILEYNEKTPGYMGASWVDSASYVWPMEQDTFVAR
FSGFLVAPDSDVYRFYIKGDDRYAIYFSQTGLPEDKIRIAYHSSNANSYFSSPTQRSDDI
HLQKGKEYYIEILLQEYRLSAFVDVGLYQYGNVYTEQQTEDAVNEEQVIQSQSAIVQEVQ
VITLENWETTNAIKEVQRITVTSPCIEVSSCSLYQYRLTYNMEKTALLPADASDFLLQSA
LNDLWSLKPDTVQVTRTQNPQSYVYTVTFISTRGDFDLLGYEVFEGYNVTLDIIEQTKGK
PSLDTFTLNWDGITSKPLTPWSAEAEFQAAVEEMVSAKCPPQIADFEEGFVVKYFRDYEN
DFNMDHINRGQKTAETDAYCGRYSLKNPAVLFDSADVKPNRLPYGDISLFPYNQLCLAYK
GFLADYIGLKFQYQDKSKITRSTDVQFTYSFAYGNNWTYTCIDLLDLIQTKYTGTNFSLQ
RISVQKASESQSFYVDIVYIGQTPTISIWDEMPKRRLPALANKGIFLKHFQVNQTKSNGS
SMTSQYSVTMTSYNCSYNIPMMAVSFGQVSLEFYKGNNWPGESRIRIQRIQAASAPLSGS
FDIQAYGHVLKGLPAAVSAADLQFALQSLEGVGRVSVTREGTCAGYSWNIKWRSACGKQA
LLQVNDSNIIGEMANMTVTKVKEGGLFRQRILGDLLRTPSQQPQVEVYVNGIPAKCSGDC
GFTWDPMTTPIIRTISPSKGSSEEGTILTISGSGFSPSSAVSVSVGPIGCSLLSVNENEI
KCQILNGSAGHFPVAVSIADVGLARNVEDKEFHFMYQSQIAHIWPVSGSLAGGNLLTLSG
TGFNENSKVLVGNETCNVIDGDLNKITCRTPKRIEGTVDISVITNGFQATAKDAYSYNCL
QTPVITDFIPRVRTILGERNLTIKGYNFGTDLKQSMEVYVGGKPCQILHWNFTKIRCLLP
TLSPGKHDIHVEVRNWGFASTRDKLNASIQYILEVNNVFPQRGSLYGGTEITIMGLGFST
IPTENTVLLGSFPCSVSSSTSDVIKLHGLGYAWSPSVLNVSVGDTVTWHWQAHPFLTGIG
YRVFSVSSPGSVTYDGKGFMNGREKSASGSFSYQFTSPGINYYSSGYVDEAHSIVLQGVI
NVLPAESRHITLHLSVGSTEATYAQGEPVNLHVGSSVTGCLATEALCGLNNTGVKNSDKL
LFELSSCFSPSISNISPSTGTVNELITITGHGFSNLTCANKVTIGSYPCVVEESSANSIV
CHIDPQNSMDVGIREIVTLTVYNLGIAINTLPNEFDRRFVLLPNIDMVLPNAGSTTGMTK
VTIKGSGFSVSSAAVEVRMGRFPCEVLSVNYTTIECETSPAPHQLVTVQLLIHGVPAQCQ
GNCSFSYSESIAASITSISPTSITGSVQALIEGEGFGTILEDIAVFIGNQQFRAVDVTDN
NITVLVTPLPAGLHPVSVVVGSKGLALGNLSVSSPAVASVRPTSGSIGGGTTLVITGNGF
YPGNTTVTVGDESCQIISVNASEVYCRTPAGAAGRVNVKIFVNAVAYPPLSFTYAWEDTP
LLREIVPSTGPPGTKIEITGSNFGTDILEISVVINNIQCNVTMVNDSVLQCIVGDHAGGT
FPVMMHRETKGSAVSTLVFEYPLTIHNIQPTQGSFGGGQMMTVTGTGFNPQNSEILVCGS
ECAVNRLKSDYTALLCKIPPNNDSYHLGRGPEQACEVSVANGKDLSRSTTPFTYTMSLTP
LITKIAPERGSTAGGTRLTVMGSGFSENTQDVRITIAETKCDVEYSNETCIICMTNAHTP
SGWAPVRVTVGSMGMAKREKADFLYVDAWSSNCSWGGEPPPEEGSLVVIPKGQTVLLDQN
TPVLKMLLIQGGTLIFDEADIELQAENILITDGGILQIGTEASPFQHKAVITLHGHLRSP
ELPVYGAKTLAVREGVLDLHGLPVPVVWTRLAHTAQAGERTLILQEAVTWKPGDKIVVAS
TGHRHSQRENEERTIEFVSADGISITLTHPLNYTHLGITVPLPDGTLFEARAEVGILTRN
ILIRGSDNVEWHHKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCIMFHAPVPGAN
MVTGRIEYVEVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQTYNRAVTIHHTHHL
LVERNIIYDIKGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTI
RHNAAAGGTHFGFWYRMNDHPDGPSYDRNICQKRIPLGEFFNNTVHSQGWFGIWIFEEYF
PMQTGSCTSTVPVPAIFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNYESGIETKRILGA
YIGGWGETNGAVIKNAKIVGHLDELGMGPAFCTMRGLVLPFSEGLTVSSVHFMNFDRPNC
VALGVTSITGVCNERCGGWSAKFADIQYFHTPNKAGFRWEHEVVLIDVDGSLTGHKGHTV
IPHSSLLDPSHCTQEAEWSVGFPGSVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFGTS
IVPFRKKRLTHMSGWMALIPNAKHINWYFKGVDHITNISYTSTFYGFKEEDYVIISHNFT
QNPDMFNVIDMRNGSSNPLSWNTSKNGDWHLEANTSTLYYLVSGRNDLPQSQPVSGNLDP
DVKDVIINFQAYCCVLQDCFPVHPPSRNPIPRKRPATYNLWSNDSFWQSSRENNYTIPHP
GANVVIPEGTWVVADTDIPPLERLIIWGVLELEDKHNVEAAESSYRKVVLNATYISLQGG
RLIGGWEDNPFKGELQIVLRGNHSTPEWAFPEGPNQGSKVLGVFGELDLHGLPRSIYKTK
LSETAEAGSKVLSLMDAVDWQEGEEIVITTTSYDIHQTETRSIAKILHGHKILILNEPLS
YTHLGERYQVPGTRQSYTLAADVGILSRNIKILGEDYPGWFQESFGARVLISSFTENMMT
FKGNARISDVEFYHSGQEGFRDSTDPRYAVTFLNLGQIQERGSSYIRGCAFHHGFSPAIG
VFGTDGLDIEDNIIHFTVGEGIRIWGDANRVRGNLVALSVWPGTYQNRKDLSSTLWHAAI
EINRGTNTVLQNNVVAGFGRAGYRIDGEPCSSLSNPLEKWSDNEAHGGLYGIYMNQDGLP
GCSLIQGFTIWMCWDYGIYFQTTESVYIHNVTLVDNGMAISSMIYMPAAISHQISNKTVQ
IKSSLIVGSSPEFNCSDLLTNDDPNIELSAAHRSSRPPSGGRSGICWPTFASAHNMAPRK
PHAGIMSYNAISGLLDVSGSTFVGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIQLVDT
IEKAKIFIHRPDIRKVNPSDCVDMVCDAKRKSFLRDMDGSFLGNSGSVIPQSEYEWNGNS
QFGIGDYRIPKVMLTFPNGSRIPVTEKAPYKGIIRDSACRYIPEWQSYRCFGMEYAMMVI
ESLDSDTETRRLSPVAIVSSGYVDLINDLGPQDHGWCAGYSCQRRLSLFHSIVALNKSYE
VYFTGTSPQNLRLMLLNVKHDKAVLVGIFFSTLQRLDVYVNNALVCPKDTVWNPQQKHCE
FNRHLHTEQFLPNLNSTVLGENYFDRTYQMLYLLVKGTMPVEIHTTAVIFVSFQIPAVTE
EDFYSSHNLVRNLALFLKIPSDKIRISKVIGGDSVRKKRSMGLTVQLEIGDPPPQFITND
TTAGQMQLSELQEVAASLGQAVILGKTSSTLGFNVSSMSLINPIPSSSDSEWIKVTAQPV
ERFAFLVHHVAVVSSLSVISQPVAAQLGQPLSQQPSVKAVDPDGNCVSVGITSLTLKAIL
KDSNNNQISGLGGNTTIPFSSYWANYTDLTLLRTGE
Download sequence
Identical sequences G1QEH3
ENSMLUP00000022106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]