SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QEL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QEL5
Domain Number 1 Region: 56-139
Classification Level Classification E-value
Superfamily HMG-box 1.96e-24
Family HMG-box 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QEL5
Sequence length 274
Comment (tr|G1QEL5|G1QEL5_MYOLU) High mobility group 20B {ECO:0000313|Ensembl:ENSMLUP00000022148} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=HMG20B OC=Vespertilionidae; Myotis.
Sequence
MSHGPKQPGAAVAPAGGKAPAQHGGFVVAVKQERGEGPRASDKGSHEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYL
DEAEREKQQYIKELRAYQQSEAYKMCTEKIQEKKIKKEDSGSGLMNTLLNGHKGGDCDGF
STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQNMSSARERLEQELAL
EERRTLALQQQLQAVRQALTASFASLPVPGAETP
Download sequence
Identical sequences G1QEL5
ENSMLUP00000022148 ENSMLUP00000022148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]