SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QEV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QEV4
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.31e-53
Family Bacterial PLC 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QEV4
Sequence length 287
Comment (tr|G1QEV4|G1QEV4_MYOLU) Phosphatidylinositol specific phospholipase C X domain containing 2 {ECO:0000313|Ensembl:ENSMLUP00000022237} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PLCXD2 OC=Vespertilionidae; Myotis.
Sequence
GSHDSFSYWVDEKSPVGPDQTRAVMRLARISLVKKLMKKWSVTQNLTFREQLDAGIRYFD
LRVSSKPGDTDQEIYFIHGLFGIKVWDGLMEIDSFLTQHPREIVFLDFNHFYAMDEAHHK
YLVHRMQEAFGNKLCSACNVESLTLQILWEKKYQVLIFYHCPFYKQYPFLWPGKKIPAPW
ANTTSVRKLILFLETTLSERAPRGSFHVSQAILTPRAKTIARGLVGGLKNTLVHRNLPVI
LDWVKTQKPGTMGVNIITSDFVDLVDFATTVIELNDLLQEDRALAKC
Download sequence
Identical sequences G1QEV4
ENSMLUP00000022237 ENSMLUP00000022237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]