SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QF43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QF43
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Ferritin-like 3.45e-31
Family Ferritin 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QF43
Sequence length 172
Comment (tr|G1QF43|G1QF43_MYOLU) Ferritin {ECO:0000256|RuleBase:RU361145} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LOC102427362 OC=Vespertilionidae; Myotis.
Sequence
KQPVSKECGVAINYVASYELHISNAYLSMACCYIDDAREPIFSGFFEDQAEVKREHGKQF
LRYLVGCGNTICLPVIKRPEVDNWQTGIKALEYALQLENQLSQLLIDLRVTAAANNDNNL
LNFMKRFLDKQRKDINHLQCQIVCYHILEKEVQEQTSQNKRPLKNTATRKMQ
Download sequence
Identical sequences G1QF43
ENSMLUP00000022326 ENSMLUP00000022326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]