SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QFB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QFB0
Domain Number 1 Region: 722-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000867
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 59-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000301
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 3 Region: 492-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000119
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 540-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000331
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 630-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000133
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 583-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000275
Family Classic zinc finger, C2H2 0.071
Further Details:      
 
Domain Number 7 Region: 784-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000028
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  G1QFB0
Domain Number - Region: 155-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00419
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 194-292
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00565
Family Galactoside acetyltransferase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QFB0
Sequence length 891
Comment (tr|G1QFB0|G1QFB0_MYOLU) Zinc finger protein 512B {ECO:0000313|Ensembl:ENSMLUP00000022393} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ZNF512B OC=Vespertilionidae; Myotis.
Sequence
GKDGSQNEVRLPVRHDPKLGLPVARGGQTMPSQAPLCFDPGSPASDRTEGKKKGRPKAEN
QALRDIPLSLMTQWKDEFKVHSRVKCPSSGCWLEFPSIYGLKYHYQRCQGVRGCGLGKRR
PEPTLPSCWLGCVCTETWAAHATPALSTQGAISERLTFPCPFCEAAFTSKTQLEKHRIWN
HMDRPLSAPKPGPVSRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPV
PVTKPVTISRPVPVTKPVTISRPVPVTKPVPVSRPVPVTKPVPVSRPVPVTKPVPVSRPV
PVTKSVTVSSRPMAISRHTPSCKMVLLTKSENKTPRATGRASGKKRAADSRDACPLPPKQ
ARSESGECGPPTTGQGSALQPSTDPSSGPLSLGSRPLGGKEVPRATGPVSLPEEGAERMK
HRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKSRGYRAKKQEGPGPEDVRKKAPAPANT
VSKEAPAPVAHSTPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDA
LKCQHCRKQFKSKAGLNYHTMAEHSAKPSDTEASEGSEQEERERLRKVLKQMGRLRCPQE
GCGAAFSSLMGYQYHQQRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHMRSEHTAPPPE
EPQDKPPEAEDLLGIERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPET
ARLNYTRPGLPTLNPQLLETWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGDH
LVEKYRCLLCPKEFSSESGVKYHILKAHAENWFRTSADSPPKHRSQGSLVPKKEKSLAGG
KKRGRRPKERLPEEPAPKMAPRQEDWPPGGRDKGAQDSTGRKVGASNSPEK
Download sequence
Identical sequences G1QFB0
ENSMLUP00000022393 ENSMLUP00000022393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]