SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QFY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1QFY8
Domain Number - Region: 24-49
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0764
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QFY8
Sequence length 49
Comment (tr|G1QFY8|G1QFY8_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000022621} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MADVFSANDSTTPLDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTF
Download sequence
Identical sequences G1QFY8
ENSMLUP00000022621 ENSMLUP00000022621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]