SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QG60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QG60
Domain Number 1 Region: 23-208,268-304
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-36
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QG60
Sequence length 313
Comment (tr|G1QG60|G1QG60_MYOLU) Jumonji domain containing 7 {ECO:0000313|Ensembl:ENSMLUP00000022693} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=JMJD7 OC=Vespertilionidae; Myotis.
Sequence
MAEAALDAVQRELREFPAAVRELNVPLAVPYLDQPPTPLHFYRDWVCPNRPCIIRRALQH
WPALQKWSLPYLRAAAGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPLSCVLDVLEGRA
QHPGVLYVQKQCSNLPTELPQLLSDLEPHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLLHPPSDRPFIPYEMYTPATYQLTEEGSFKMVDEEAMEKVCVLFL
GPREREGSRHKRAGVVAPCSEKPRSLGPPSAEQDRVPGSHGCIAVNFWYDMEYDLKYSYF
QLLDSLTKASGLA
Download sequence
Identical sequences G1QG60
ENSMLUP00000022693 ENSMLUP00000022693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]