SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QKT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QKT6
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000102
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000301
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QKT6
Sequence length 264
Comment (tr|G1QKT6|G1QKT6_NOMLE) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSNLEP00000001535} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=SBSPON OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRTLWMALCALVRLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAG
CLEYSTPQGQDCGHTYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences G1QKT6
ENSNLEP00000001535 ENSNLEP00000001535 XP_012351509.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]