SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QL67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QL67
Domain Number 1 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000119
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number 2 Region: 38-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000445
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  G1QL67
Domain Number - Region: 120-142
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0062
Further Details:      
 
Domain Number - Region: 146-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00114
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number - Region: 92-117
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.089
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QL67
Sequence length 179
Comment (tr|G1QL67|G1QL67_NOMLE) Cleavage and polyadenylation specific factor 4 like {ECO:0000313|Ensembl:ENSNLEP00000001680} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CPSF4L OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHD
RGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECPFLHVKPAFK
SQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI
Download sequence
Identical sequences G1QL67
XP_003279670.1.23891 ENSNLEP00000001680 ENSNLEP00000001680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]