SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QLG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QLG6
Domain Number 1 Region: 180-300
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000612
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  G1QLG6
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QLG6
Sequence length 324
Comment (tr|G1QLG6|G1QLG6_NOMLE) Cysteine rich with EGF like domains 2 {ECO:0000313|Ensembl:ENSNLEP00000001781} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CRELD2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAW
EEKTLSKYESSEIRLLEILEGLCDSSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFC
VKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHVGYQGPLCTDC
MDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAETPP
CSAAQFCKNANGSYTCEDVDECSLAEKACVRKNENCYNTPGSYVCVCPDGFEETEDACVP
PAEAGEWHGSLHTGCPPLHGGACT
Download sequence
Identical sequences G1QLG6
ENSNLEP00000001781 XP_012363265.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]