SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QR81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QR81
Domain Number 1 Region: 427-740
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000668
Family Rhodopsin-like 0.017
Further Details:      
 
Weak hits

Sequence:  G1QR81
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0174
Family Integrin beta EGF-like domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QR81
Sequence length 797
Comment (tr|G1QR81|G1QR81_NOMLE) Adhesion G protein-coupled receptor G7 {ECO:0000313|Ensembl:ENSNLEP00000003449} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ADGRG7 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MASCRAWNLRVLVAVVCGLLTGIILALGIWRIVVRIQRGKSSSSSSTPTEFCRNGGTWED
GRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAIRL
CSLSLYGEIELQNVTIGNCNENLETLEKQIKDVTAPLNNISSEVQILTSDANKLTAENIT
SATRVVGQIFNTSRNASPEAKKVAVVTVSQLLDASEDAFERVAATANDDALTTLIEQMET
YSLSLGNQSVVEPNIAIQSANFSSENAVGPSNVRFSVQKGASSSLVSSSTFIHTNVDGLN
PDGQTELQVLLNMTKNYTKTCGFVVYQNDKLFQSKTFTAKSDFSQKIISSKTDENEQDQS
ASVDMVFSPKYNQKEFQLYSYACVYWNLSTKDWDTYGCQKDKSTDGFLRCRCNHTTNFAV
LMTFKKDYQYPQSLDILSNVGCALSITGLALTIIFQIVTRKVRKTSVTWVLVNLCISMLI
FNLLFVFGIENSNKNLKASDGDINNIDFDNNDVPRTDTINIPNPMCTAIAALLHYFLLVT
FTWNALSAAQLYFLLIRTMKPLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGKNPQWE
LDYRQEKICWLAIPEPNGVIKSPLLWSFIIPITIILISNVVIFIIISIKVLWKNNQNLTS
TKKVSSMKKIVSTLSVAVVFGITWILAYLMLVNDDSIRIVFSYVFCLFNTTQGLQIFILY
TVRTKIFQSEASKVLMSLSSIGRRKSLPSVTRPRLRIKMYNFLRSLPTLHERFRLLETSL
SSEEITLSESDKAKESI
Download sequence
Identical sequences G1QR81
ENSNLEP00000003449 XP_003261787.1.23891 ENSNLEP00000003449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]