SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QRY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QRY9
Domain Number 1 Region: 213-459
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-84
Family Eukaryotic proteases 0.00000000777
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 2.55e-25
Family GLA-domain 0.0000916
Further Details:      
 
Domain Number 3 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000478
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QRY9
Sequence length 461
Comment (tr|G1QRY9|G1QRY9_NOMLE) Coagulation factor IX {ECO:0000313|Ensembl:ENSNLEP00000003707} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=F9 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSKLTRAEIVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIVNEKWIVTAAHCIETGVKITVVAGKHNIEETEHTEQKRNVIRII
PHHNYNAAINKYNHDIALMELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
NKGRSASVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences G1QRY9
ENSNLEP00000003707 XP_003272634.1.23891 ENSNLEP00000003707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]