SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QSI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QSI6
Domain Number 1 Region: 151-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.62e-58
Family Protein kinases, catalytic subunit 0.00066
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily DEATH domain 1.28e-28
Family DEATH domain, DD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QSI6
Sequence length 596
Comment (tr|G1QSI6|G1QSI6_NOMLE) Interleukin 1 receptor associated kinase 3 {ECO:0000313|Ensembl:ENSNLEP00000003904} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=IRAK3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLTERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTVGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANITVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKNMQCKKHWKRFLSELEVLLLFRHPNILELAAYFTETEKFCLV
YPYMRNGTLFDRLQCVGDTAPLPWHIRISILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKAESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNMDPSSEAPGHSCRSRPVDSSCSSKFSWDEYKQYKKE
Download sequence
Identical sequences G1QSI6
ENSNLEP00000003904 ENSNLEP00000003904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]