SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QTB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QTB1
Domain Number 1 Region: 150-279
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000863
Family 28-residue LRR 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QTB1
Sequence length 428
Comment (tr|G1QTB1|G1QTB1_NOMLE) Leucine rich repeat containing 42 {ECO:0000313|Ensembl:ENSNLEP00000004179} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LRRC42 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNRE
DDTAQKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFS
AAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDL
SCCKLGDEHELLEHLTNEALSSVTQLHLKDNCLSDAGVRKMTAPVRVMKRGLENLTLLDL
SCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKTVKHKLQTHIGLVHSKVPLKEFDHSN
CKTEGWADQIVLQWERVTAEAVKPRETSEPRAAAQRFYGKRSRAEAPLKCPLADTHMNSS
EKLQFYKEKAPDCHGPVLKHEAISSQESKKSKKRPFEESETEQNNSSQPSKQKYVCLAVE
DWDLLNSY
Download sequence
Identical sequences G1QTB1 G3R555
ENSGGOP00000010423 XP_004025885.1.27298 XP_004025886.1.27298 XP_012362254.1.23891 XP_018874441.1.27298 ENSNLEP00000004179 ENSNLEP00000004179 ENSNLEP00000024429 ENSGGOP00000010423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]