SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QTZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QTZ5
Domain Number 1 Region: 33-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000469
Family V set domains (antibody variable domain-like) 0.038
Further Details:      
 
Weak hits

Sequence:  G1QTZ5
Domain Number - Region: 144-288
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0288
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QTZ5
Sequence length 323
Comment (tr|G1QTZ5|G1QTZ5_NOMLE) CD47 molecule {ECO:0000313|Ensembl:ENSNLEP00000004415} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CD47 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT
REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL
VAGLMITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA
ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
PPRKAVEEPLNAFKESKGMMNDE
Download sequence
Identical sequences G1QTZ5
XP_003261819.1.23891 XP_018879794.1.27298 ENSNLEP00000004415 ENSNLEP00000004415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]