SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QU35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QU35
Domain Number 1 Region: 119-215
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 44-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000005
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QU35
Sequence length 262
Comment (tr|G1QU35|G1QU35_NOMLE) Transmembrane and immunoglobulin domain containing 1 {ECO:0000313|Ensembl:ENSNLEP00000004455} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TMIGD1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAWKSSVIMQMGRFILLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLTCAVQNHT
REEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSISVVLNVT
FPPLLSGNDFQTVEEGSNVKLVCNVQANPQAQMMWYKNSSLLDLEKSHHQIQQTSESFQL
SITKVEKSDNGTYSCIAKSSLKTESLDFHLIVKDKTVRVPIEPIIAACVVIFLTLCFGLI
ARRKKIMKRCMKDKDPHRETAL
Download sequence
Identical sequences G1QU35
ENSNLEP00000004455 XP_003277129.1.23891 ENSNLEP00000004455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]