SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QUL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QUL3
Domain Number 1 Region: 611-836
Classification Level Classification E-value
Superfamily vWA-like 3.71e-63
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 46-238
Classification Level Classification E-value
Superfamily vWA-like 8.62e-57
Family Integrin A (or I) domain 0.00024
Further Details:      
 
Domain Number 3 Region: 323-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 405-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 240-330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000146
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 567-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000149
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 912-953
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000000353
Family Chicken cartilage matrix protein 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QUL3
Sequence length 956
Comment (tr|G1QUL3|G1QUL3_NOMLE) Matrilin 2 {ECO:0000313|Ensembl:ENSNLEP00000004633} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=MATN2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEKMLAGCFLLILGQILLLPAEGRERSRGRSISRGRHARTHPQTALLESSCENKRADLVF
IIDSSRSVNTHDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEV
ERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEV
AAKARDTGILIFAIGVGQVDFNTLKAIGSEPHEDHVFLVANFSQIETLTSVFQKKLCTAH
MCSTLEHNCAHFCINIPGSYVCRCKQGYILNSDQRTCRIQDLCAMEDHNCEQLCVNVPGS
FVCQCYSGYALAEDGKRCVAVDYCASENHGCEHECVNADGSYLCQCREGFALNPDKKTCT
KINYCASSNHGCQHECVNTDDSYSCRCLKGFTLNPDKKTCRRINYCALNKPGCEHECINT
EESYYCRCRRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEDSFVCQCSEGFLINEDLK
TCSRVDYCLLSDHGCEYSCVNMDRSFACQCPEGHVLRSDGKTCAKLDSCALGDHGCEHSC
VSSEDSFVCQCFEGYILREDGKTCRRKDVCQAIDHGCEHICVNSDDSYTCKCLEGFRLAE
DGKHCRRKDVCKSTHHGCEHICVNDGNSYICKCSEGFVLAEDGRQCKKCTEGPIDLVFVI
DGSKSLGEENFEVVKQFVTGIIDSLTISPKAARVGLLQYSTQVRTEFTLRNFNSAKDMKK
AVAHMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGRAQDDVSEWAS
KAKANGITMYAVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
SDGRQDSPAGELPKRVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEEDNLLRSTQKLSH
STKPSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRLEEMTQRMEALENRLRYR
Download sequence
Identical sequences G1QUL3
XP_004090784.1.23891 ENSNLEP00000004633 ENSNLEP00000004633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]