SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QWB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QWB5
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.79e-68
Family TRADD, N-terminal domain 0.0000000462
Further Details:      
 
Domain Number 2 Region: 220-304
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000016
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QWB5
Sequence length 311
Comment (tr|G1QWB5|G1QWB5_NOMLE) TNFRSF1A associated via death domain {ECO:0000313|Ensembl:ENSNLEP00000005236} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TRADD OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQRSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAQGGDGEVASAPL
QPPVPSLSEAKPPPPPPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLTDPNGGLA
Download sequence
Identical sequences G1QWB5
ENSNLEP00000005236 ENSNLEP00000023448 XP_003262922.1.23891 XP_012360577.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]