SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QX52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QX52
Domain Number 1 Region: 24-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QX52
Sequence length 807
Comment (tr|G1QX52|G1QX52_NOMLE) Tyrosine-protein phosphatase {ECO:0000256|RuleBase:RU364084} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PTPN22 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDQREILQKFLDEAQSKKINKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWILLKDGIIPENFSVFSLIWEMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKYSIPEQNHTLQADSYSPKLPKSTIKAAKMMNQQRTKMENKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKRQTKAFPTVGEPLQKHKSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVYSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQICNASNVKHHDSSALGVYSYIPLVEDPYLSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFPYYNSHDSLSLNSPTNISPLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEDVGEFSPNVPKSLSSAVKVKVGTSLEWGGTS
EPKKFDDSVRLRPSKSVKLQSPKSELRQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQILKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
Download sequence
Identical sequences G1QX52
ENSNLEP00000005523 XP_003268047.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]