SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QXA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QXA1
Domain Number 1 Region: 214-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.0074
Further Details:      
 
Weak hits

Sequence:  G1QXA1
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.00045
Family Fibronectin type I module 0.04
Further Details:      
 
Domain Number - Region: 278-323
Classification Level Classification E-value
Superfamily FnI-like domain 0.0534
Family Fibronectin type I module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QXA1
Sequence length 325
Comment (tr|G1QXA1|G1QXA1_NOMLE) von Willebrand factor C domain containing 2 {ECO:0000313|Ensembl:ENSNLEP00000005572} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=VWC2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVN
ELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQDGGAKAGDLQVRPRGDTPQG
EALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences G1QXA1
ENSNLEP00000005572 ENSNLEP00000005572 XP_003268971.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]