SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QYI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QYI8
Domain Number 1 Region: 38-136
Classification Level Classification E-value
Superfamily Immunoglobulin 3.56e-17
Family V set domains (antibody variable domain-like) 0.00000818
Further Details:      
 
Domain Number 2 Region: 153-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000835
Family C2 set domains 0.00000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QYI8
Sequence length 288
Comment (tr|G1QYI8|G1QYI8_NOMLE) CD80 molecule {ECO:0000313|Ensembl:ENSNLEP00000006009} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CD80 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MGHTRRQATSPFKCPYLNFFQLLVLAGLSCFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTSNHSFMCLIKYGHLRVNQTFNWNTPKQEHFP
DNLLPSWAITLISVNGIFVTCCLTYCFAPRCRERRRNERLRRESVRPI
Download sequence
Identical sequences G1QYI8
ENSNLEP00000006009 ENSNLEP00000006009 XP_003261902.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]