SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QZ20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QZ20
Domain Number 1 Region: 106-424
Classification Level Classification E-value
Superfamily RNI-like 4.63e-61
Family 28-residue LRR 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QZ20
Sequence length 464
Comment (tr|G1QZ20|G1QZ20_NOMLE) Leucine rich repeat containing 34 {ECO:0000313|Ensembl:ENSNLEP00000006191} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LRRC34 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAAQPPRPVGERSMGSPREAARAPARSPAWASTQARTPGAALAVQRESPESGLQEHYSNL
CMEKSQKINPFILHILQKVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILK
NCLYINGLDVGYNLLCDVGAYYAMKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRT
LKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTRNQAIKAI
NLNRPILYGEQEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNNSLRYLD
VSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVS
NNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEATCVAYSHLIQTGCLKPDNTDVEPFVV
DGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP
Download sequence
Identical sequences G1QZ20
XP_003256477.1.23891 ENSNLEP00000006191 ENSNLEP00000006191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]