SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QZ62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QZ62
Domain Number 1 Region: 228-483
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-63
Family Eukaryotic proteases 0.000000126
Further Details:      
 
Domain Number 2 Region: 46-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-23
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Weak hits

Sequence:  G1QZ62
Domain Number - Region: 190-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000105
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QZ62
Sequence length 487
Comment (tr|G1QZ62|G1QZ62_NOMLE) Complement C1r subcomponent like {ECO:0000313|Ensembl:ENSNLEP00000006233} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=C1RL OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPGPRVWGKYPCRSPHSTDCPGAMWWLLLWGVLQACPTRGSLLLAQELPQQLTSPGYPEP
YRKGQESSTDIKAPEGFAVSLIFQDFDLEPSQDCAGDSVTISGSGSDPSQFCGQQGSPLG
RPPGQREFISSGRSLRLTFRTQPSSENRTAHLHKGFLALYQTVAVNYSQPISEASRGSEA
INAPGDNPAKVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPIA
QNQTTLGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILTAAHTIYPKDSVSLRKNQSVN
VFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCL
PDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVASREACNAWLQKRQRPEVFSDNMF
CVGDETQRPSVCQGDSGSVYVVWDDHAHHWVATGIVSWGIGCGEGYDFYTKVLSYVDWIK
GVMNGKN
Download sequence
Identical sequences G1QZ62
XP_003273827.1.23891 ENSNLEP00000006233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]