SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R137 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R137
Domain Number 1 Region: 20-184
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.75e-46
Family Dual specificity phosphatase-like 0.0000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1R137
Sequence length 185
Comment (tr|G1R137|G1R137_NOMLE) Dual specificity phosphatase 3 {ECO:0000313|Ensembl:ENSNLEP00000006908} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=DUSP3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKIGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Download sequence
Identical sequences G1R137
XP_003270819.1.23891 XP_012353160.1.23891 XP_012353161.1.23891 ENSNLEP00000006908 ENSNLEP00000006908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]