SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R1E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R1E9
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.59e-16
Family FHA domain 0.0022
Further Details:      
 
Domain Number 2 Region: 296-342
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000554
Family PHD domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1R1E9
Sequence length 345
Comment (tr|G1R1E9|G1R1E9_NOMLE) Transcription factor 19 {ECO:0000313|Ensembl:ENSNLEP00000007021} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TCF19 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAEL
HAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM
FQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSLGAPQRPLSTLSPAPKATLILNSIG
SLSKLQPQPLTFSPSWGGPKGLPVPTPPGEVGTTPSAPPQRNRRKSVHRVLAELDDESEP
PENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPCCCLP
QEETVAWVQCDGCDIWFHVACVGCSIQAAREADFRCPGCRAGIQT
Download sequence
Identical sequences G1R1E9
ENSNLEP00000007021 ENSNLEP00000023627 XP_003272124.1.23891 ENSNLEP00000007021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]