SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R1Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R1Z6
Domain Number 1 Region: 46-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-38
Family SCAN domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.58e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.54e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 685-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 224-285
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000017
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1R1Z6
Sequence length 753
Comment (tr|G1R1Z6|G1R1Z6_NOMLE) Zinc finger with KRAB and SCAN domains 7 {ECO:0000313|Ensembl:ENSNLEP00000007218} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ZKSCAN7 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MTTAGRGNLGLIPRSTAFQKQEGRPTVKQEPANQTWGQGSSLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
NGEEAVAVVEDFQRHLSGPEEVSAPAQKQEMHLEETTALGATKESPPTSPLSGGSAPGVD
LEPPYDPGTHHLPNGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDAVAYEDLSVDY
TQKKWKGLPLSQRALQWNMMPENDRSMASLAGENMMKGSELTPKQEIFKGSESSNRTSGG
LFGVVPGAAKTGDVCEDTFKELEGQTSDEERSRLENDFLEITDEDKKKSTKDRYDKYKEV
GEHPHLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF
RQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSS
RLIDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLID
HQRIHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERI
HTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGE
KPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYE
CSECGKAFSQRSTFNHHQRTHTGEKSGLAWSVS
Download sequence
Identical sequences G1R1Z6
ENSNLEP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]