SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R3T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R3T6
Domain Number 1 Region: 100-124
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000301
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1R3T6
Sequence length 426
Comment (tr|G1R3T6|G1R3T6_NOMLE) Zinc finger CCCH-type containing 15 {ECO:0000313|Ensembl:ENSNLEP00000007858} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ZC3H15 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQV
AQSEAEKKLKKDDKKKELQELNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCK
FSHDLTLERKCEKRSVYIDARDEELEKDTMDNWDEKKLEEVVNKKHGEAEKKKPKTQIVC
KHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERER
SALGPNVTKITLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPE
LVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIPRDVDETGITVASLERFSTYTS
DKDENKLSEASGGRAENGERSDLEEDNEREGPENRAIDAVPVDENLFTGEDLDELEEELN
TLDLEE
Download sequence
Identical sequences G1R3T6
XP_003253875.1.23891 ENSNLEP00000007858 ENSNLEP00000007858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]