SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R4L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R4L1
Domain Number 1 Region: 28-74
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000249
Family Elafin-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1R4L1
Sequence length 111
Comment (tr|G1R4L1|G1R4L1_NOMLE) WAP four-disulfide core domain 12 {ECO:0000313|Ensembl:ENSNLEP00000008133} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=WFDC12 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MGSSSFLVLMVSLALVTLVAVEGVKEGIEKAGVCPADNIRCFKSDPPQCHTDQDCLGERK
CCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKSPGSSSTRCPQK
Download sequence
Identical sequences G1R4L1
ENSNLEP00000008133 XP_003253670.1.23891 ENSNLEP00000008133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]