SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R4T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R4T8
Domain Number 1 Region: 30-87
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1R4T8
Sequence length 89
Comment (tr|G1R4T8|G1R4T8_NOMLE) Serine peptidase inhibitor, Kunitz type 3 {ECO:0000313|Ensembl:ENSNLEP00000008210} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=SPINT3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCRTYMMRWFFNLETGE
CELFAYGGCGGNSNNFSRKEKCEKFCKFT
Download sequence
Identical sequences G1R4T8
ENSNLEP00000008210 XP_003253689.1.23891 ENSNLEP00000008210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]