SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R4T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R4T9
Domain Number 1 Region: 34-71
Classification Level Classification E-value
Superfamily Elafin-like 0.00000222
Family Elafin-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1R4T9
Sequence length 86
Comment (tr|G1R4T9|G1R4T9_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000008211} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=WFDC6 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MGLSGLLPILVPFILLGDVQEPGHAEGIFGKPRPKIKVECKVEEIDQCTKPRDCPENMKC
CLFSRGKKCLDLRKVSLTLYHKEELE
Download sequence
Identical sequences G1R4T9
ENSNLEP00000008211 XP_003253691.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]