SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1R4V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1R4V7
Domain Number - Region: 51-86
Classification Level Classification E-value
Superfamily Elafin-like 0.00157
Family Elafin-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1R4V7
Sequence length 89
Comment (tr|G1R4V7|G1R4V7_NOMLE) WAP four-disulfide core domain 10B {ECO:0000313|Ensembl:ENSNLEP00000008229} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=WFDC10B OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MVSCERRASKSVGQILLWDFGYTCTLSHRRRNSTEILSRSLPALYTGIKVCEKRPSIDLC
IHHCSYFQKCEANNICCSAFCGNVCMSIL
Download sequence
Identical sequences G1R4V7
ENSNLEP00000008229 XP_012367201.1.23891 ENSNLEP00000008229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]